PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.BXX66
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 182aa    MW: 20622.9 Da    PI: 6.5157
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.BXX66genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.6e-29105154251
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                  prlrWtp+LH +Fv+av++LGG+e+AtPk +l+lm+v gL+++hvkSHLQ
  Araip.BXX66 105 PRLRWTPDLHLAFVQAVNRLGGQERATPKLVLQLMNVRGLSIAHVKSHLQ 154
                  8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-26101154IPR009057Homeodomain-like
SuperFamilySSF466896.45E-13103155IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-20105154IPR006447Myb domain, plants
PfamPF002493.2E-8106154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MGERIIEGKE GSCSLITSPN NGSRKRSFID LNEEAGDHEN RSNNNDNEIC SSSWQEGNLS  60
SSNNNNNTTS SSEEEEEEDE GGNNNKNNKG RTTSMVRQYV RSKMPRLRWT PDLHLAFVQA  120
VNRLGGQERA TPKLVLQLMN VRGLSIAHVK SHLQASSYIY IYLILFGCLD ILFIYFFIKL  180
NF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015936407.19e-77PREDICTED: uncharacterized protein LOC107462350
RefseqXP_015936408.19e-77PREDICTED: uncharacterized protein LOC107462350
TrEMBLA0A072VAU21e-37A0A072VAU2_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
TrEMBLA0A072VBV53e-38A0A072VBV5_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.18e-31G2-like family protein